Rabbit anti-Human Calponin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16948P

• Product Name:
• Rabbit anti-Human Calponin Monoclonal Antibody

• Synonym:
• SMCC; Sm-Calp; HEL-S-14; Calponin

• Description:
• The antibody against Calponin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 198-297 of human Calponin (P51911) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 198-297 of human Calponin (P51911).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Calponin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA

• Gene ID:
• 1264

• Uniprot-ID:
• P51911

• Purification Method:
• Mouse lung, Mouse kidney, Mouse heart, Rat lung, Rat uterus

• Positive Samples:
• Affinity purification