Rabbit anti-Human Cadherin 16 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14233P

• Product Name:
• Rabbit anti-Human Cadherin 16 Monoclonal Antibody

• Synonym:
• Ksp cadherin; Cadherin 16

• Description:
• The antibody against Cadherin 16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cadherin 16

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GAEGQIVLSGDSGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMF

• Gene ID:
• 1014

• Uniprot-ID:
• O75309

• Purification Method:
• Mouse kidney

• Positive Samples:
• Affinity purification