Rabbit anti-Human c-Myc Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17273P

• Product Name:
• Rabbit anti-Human c-Myc Monoclonal Antibody

• Synonym:
• MRTL; MYCC; c-Myc; bHLHe39; yc

• Description:
• The antibody against c-Myc was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA, CUT&Tag.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ChIP, ELISA, CUT&Tag

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• c-Myc

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE

• Gene ID:
• 4609

• Uniprot-ID:
• P01106

• Purification Method:
• Jurkat, MCF7, HCT 116, Mouse ovary

• Positive Samples:
• Affinity purification