Rabbit anti-Human BTN3A1/2/3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15677P

• Product Name:
• Rabbit anti-Human BTN3A1/2/3 Monoclonal Antibody

• Synonym:
• BTF5; BT3.1; CD277; BTN3.1; BTN3A1/2/3

• Description:
• The antibody against BTN3A1/2/3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-630 of human BTN3A1(NP_008979.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 470-630 of human BTN3A1(NP_008979.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• BTN3A1/2/3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

• Gene ID:
• 111191111810384

• Uniprot-ID:
• O00481

• Purification Method:

• Positive Samples:
• Affinity purification