Rabbit anti-Human Biotin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08565P

• Product Name:
• Rabbit anti-Human Biotin Monoclonal Antibody

• Synonym:
• p50; Bp50; CDW40; TNFRSF5

• Description:
• The antibody against Biotin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Biotin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

• Gene ID:
• 958

• Uniprot-ID:
• P25942

• Positive Samples:
• Affinity purification