• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human Biotin Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-08565P
  • Product Name:
  • Rabbit anti-Human Biotin Monoclonal Antibody
  • Synonym:
  • p50; Bp50; CDW40; TNFRSF5
  • Description:
  • The antibody against Biotin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (NP_001241.1).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • FC
  • Storage Buffer:
  • PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
  • Storage:
  • Store at 2-8℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • Biotin
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
  • Gene ID:
  • 958
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human PerCP/Cyanine5.5 Monoclonal Antibody-ADA-08564P
  • Online Inquiry

    refresh