Rabbit anti-Human Bcl-2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16745P

• Product Name:
• Rabbit anti-Human Bcl-2 Monoclonal Antibody

• Synonym:
• Bcl-2; PPP1R50

• Description:
• The antibody against Bcl-2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (NP_000624.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (NP_000624.2)

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Bcl-2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA

• Gene ID:
• 596

• Uniprot-ID:
• P10415

• Purification Method:
• NIH/3T3, Mouse spleen, Rat thymus

• Positive Samples:
• Affinity purification