Rabbit anti-Human BCL2L15 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15355P

• Product Name:
• Rabbit anti-Human BCL2L15 Monoclonal Antibody

• Synonym:
• Bfk; C1orf178; BCL2L15

• Description:
• The antibody against BCL2L15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human BCL2L15 (NP_001010922.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human BCL2L15 (NP_001010922.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• BCL2L15

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWENLES

• Gene ID:
• 440603

• Uniprot-ID:
• Q5TBC7

• Purification Method:
• HT-29

• Positive Samples:
• Affinity purification