• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human BCL2L12 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-14276P
  • Product Name:
  • Rabbit anti-Human BCL2L12 Monoclonal Antibody
  • Description:
  • The antibody against BCL2L12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P, IP, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • BCL2L12
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
  • Gene ID:
  • 83596
  • Purification Method:
  • MCF7, PC-3
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human TC10/RHOQ Monoclonal Antibody-ADA-14275P
  • Online Inquiry

    refresh