Rabbit anti-Human ATG16L1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16462P

• Product Name:
• Rabbit anti-Human ATG16L1 Monoclonal Antibody

• Synonym:
• IBD10; WDR30; APG16L; ATG16A; ATG16L; ATG16L1

• Description:
• The antibody against ATG16L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 6-105 of human ATG16L1 (Q676U5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 6-105 of human ATG16L1 (Q676U5).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ATG16L1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGE

• Gene ID:
• 55054

• Uniprot-ID:
• Q676U5

• Purification Method:
• HeLa, Jurkat, U-87MG, Mouse thymus

• Positive Samples:
• Affinity purification