Rabbit anti-Human ATG12 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15056P

• Product Name:
• Rabbit anti-Human ATG12 Monoclonal Antibody

• Synonym:
• APG12; FBR93; APG12L; HAPG12; ATG12

• Description:
• The antibody against ATG12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG12 (NP_004698.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG12 (NP_004698.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ATG12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL

• Gene ID:
• 9140

• Uniprot-ID:
• O94817

• Purification Method:
• HCT 116, 293T

• Positive Samples:
• Affinity purification