Rabbit anti-Human ATG10 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16640P

• Product Name:
• Rabbit anti-Human ATG10 Monoclonal Antibody

• Synonym:
• APG10; APG10L; pp12616; ATG10

• Description:
• The antibody against ATG10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 121-220 of human ATG10 (Q9H0Y0).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ATG10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

• Gene ID:
• 83734

• Uniprot-ID:
• Q9H0Y0

• Purification Method:
• HeLa, 293T, K-562, SH-SY5Y, Mouse heart

• Positive Samples:
• Affinity purification