Rabbit anti-Human Arp2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14004P

• Product Name:
• Rabbit anti-Human Arp2 Monoclonal Antibody

• Synonym:
• ARP2; Arp2

• Description:
• The antibody against Arp2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 295-394 of human Arp2 (P61160) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 295-394 of human Arp2 (P61160).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Arp2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR

• Gene ID:
• 10097

• Uniprot-ID:
• P61160

• Purification Method:
• HeLa, HepG2, MCF7, NIH/3T3, C6, Mouse brain, Mouse thymus, Rat spleen, Rat kidney

• Positive Samples:
• Affinity purification