Rabbit anti-Human Aromatase (CYP19A1) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14446P

• Product Name:
• Rabbit anti-Human Aromatase (CYP19A1) Monoclonal Antibody

• Synonym:
• ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM; Aromatase (CYP19A1)

• Description:
• The antibody against Aromatase (CYP19A1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Aromatase (CYP19A1)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS

• Gene ID:
• 1588

• Uniprot-ID:
• P11511

• Purification Method:
• U-87MG

• Positive Samples:
• Affinity purification