• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human alpha Sarcoglycan (SGCA) Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-14297P
  • Product Name:
  • Rabbit anti-Human alpha Sarcoglycan (SGCA) Monoclonal Antibody
  • Synonym:
  • ADL; DAG2; 50DAG; DMDA2; LGMD2D; LGMDR3; SCARMD1; adhalin; alpha Sarcoglycan (SGCA)
  • Description:
  • The antibody against alpha Sarcoglycan (SGCA) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha Sarcoglycan (SGCA) (SGCA) (Q16586).
  • Species Reactivity:
  • Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, IHC-P, IF/ICC, ELISA
  • Storage Buffer:
  • PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • alpha Sarcoglycan (SGCA)
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH
  • Gene ID:
  • 6442
  • Purification Method:
  • Rat heart, Rat skeletal muscle
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human Plectin Monoclonal Antibody-ADA-14296P
  • Online Inquiry

    refresh