Rabbit anti-Human ALDH16A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13448P

• Product Name:
• Rabbit anti-Human ALDH16A1 Monoclonal Antibody

• Description:
• The antibody against ALDH16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ALDH16A1 (Q8IZ83) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ALDH16A1 (Q8IZ83).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ALDH16A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPGARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE

• Gene ID:
• 126133

• Uniprot-ID:
• Q8IZ83

• Purification Method:
• Hep G2, RD, K-562, Mouse large intestine, Mouse liver, Mouse kidney, Rat liver

• Positive Samples:
• Affinity purification