Rabbit anti-Human AKR1C3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13809P

• Product Name:
• Rabbit anti-Human AKR1C3 Monoclonal Antibody

• Synonym:
• DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS; AKR1C3

• Description:
• The antibody against AKR1C3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human AKR1C3 (P42330) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human AKR1C3 (P42330).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• AKR1C3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD

• Gene ID:
• 8644

• Uniprot-ID:
• P42330

• Purification Method:
• HepG2, Mouse liver

• Positive Samples:
• Affinity purification