Rabbit anti-Human AER61 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14570P

• Product Name:
• Rabbit anti-Human AER61 Monoclonal Antibody

• Synonym:
• AOS4; AER61; EOGT1; C3orf64

• Description:
• The antibody against AER61 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AER61 (NP_775925.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human AER61 (NP_775925.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• AER61

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRY

• Gene ID:
• 285203

• Uniprot-ID:
• Q5NDL2

• Purification Method:
• 293T, HepG2, Mouse lung, Rat uterus, Rat lung

• Positive Samples:
• Affinity purification