Rabbit anti-Human ADAMTS1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15396P

• Product Name:
• Rabbit anti-Human ADAMTS1 Monoclonal Antibody

• Synonym:
• ADAMTS1; C3-C5; METH1; ADAM metallopeptidase with thrombospondin type 1 motif 1

• Description:
• The antibody against ADAMTS1 was raised in Rabbit using the recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequen cecorresponding to amino acids 50-174 of human ADAMTS1(NP_008919.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ADAMTS1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGRPSEEDEELVVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPG

• Gene ID:
• 9510

• Uniprot-ID:
• Q9UHI8

• Positive Samples:
• Affinity purification