Rabbit anti-Human ACSL3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16685P

• Product Name:
• Rabbit anti-Human ACSL3 Monoclonal Antibody

• Synonym:
• ACS3; FACL3; LACS3; LACS 3; PRO2194; ACSL3

• Description:
• The antibody against ACSL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 600-700 of human ACSL3 (NP_004448.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ACSL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL

• Gene ID:
• 2181

• Uniprot-ID:
• O95573

• Purification Method:
• K-562, HeLa, Mouse spinal cord, Rat brain

• Positive Samples:
• Affinity purification