Rabbit anti-Human βIII-Tubulin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17092P

• Product Name:
• Rabbit anti-Human βIII-Tubulin Monoclonal Antibody

• Synonym:
• CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; βIII-Tubulin

• Description:
• The antibody against βIII-Tubulin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin (Q13509) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin (Q13509).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• βIII-Tubulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK

• Gene ID:
• 10381

• Uniprot-ID:
• Q13509

• Purification Method:
• SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain

• Positive Samples:
• Affinity purification