Rabbit anti- UCP3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16407P

• Product Name:
• Rabbit anti- UCP3 Monoclonal Antibody

• Synonym:
• SLC25A9; UCP3

• Description:
• The antibody against UCP3 was raised in Rabbit using a synthesized peptide derived from human UCP3 as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthesized peptide derived from human UCP3.

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• UCP3

• Form:
• Liquid

• Immunogen Sequence:
• MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF

• Gene ID:
• 7352

• Uniprot-ID:
• P55916

• Purification Method:
• Mouse skeletal muscle

• Positive Samples:
• Affinity purification