Rabbit anti- PSMA7 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15609P

• Product Name:
• Rabbit anti- PSMA7 Monoclonal Antibody

• Synonym:
• C6; HSPC; RC6-1; XAPC7; HEL-S-276; [KD Validated] PSMA7

• Description:
• The antibody against PSMA7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-248 of human PSMA7 (NP_002783.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-248 of human PSMA7 (NP_002783.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PSMA7

• Form:
• Liquid

• Immunogen Sequence:
• SGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

• Gene ID:
• 5688

• Uniprot-ID:
• O14818

• Purification Method:
• 293T, Caco-2, U-2 OS, Mouse brain

• Positive Samples:
• Affinity purification