Rabbit anti- PE Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08307P

• Product Name:
• Rabbit anti- PE Monoclonal Antibody

• Synonym:
• CD244; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; CD244 molecule

• Description:
• The antibody against PE was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 22-221of human CD244/2B4 (NP_001160135.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 22-221of human CD244/2B4 (NP_001160135.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PE

• Form:
• Liquid

• Immunogen Sequence:
• CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA

• Gene ID:
• 51744

• Uniprot-ID:
• Q9BZW8

• Positive Samples:
• Affinity purification