Rabbit anti- NLRP3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16953P

• Product Name:
• Rabbit anti- NLRP3 Monoclonal Antibody

• Synonym:
• FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; NLRP3

• Description:
• The antibody against NLRP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NLRP3

• Form:
• Liquid

• Immunogen Sequence:
• MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDR

• Gene ID:
• 216799

• Uniprot-ID:
• Q8R4B8

• Purification Method:
• RAW 264.7+LPS, RAW 264.7

• Positive Samples:
• Affinity purification