• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti- IL1β Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-16836P
  • Product Name:
  • Rabbit anti- IL1β Monoclonal Antibody
  • Synonym:
  • IL-1; IL1F2; IL1beta; IL1-BETA; IL1β
  • Description:
  • The antibody against IL1β was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of IL1β (NP_000567.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 170-269 of IL1β (NP_000567.1).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • IL1β
  • Form:
  • Liquid
  • Immunogen Sequence:
  • DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Gene ID:
  • 3553
  • Purification Method:
  • THP-1+LPS
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human Caspase-1 p20 Monoclonal Antibody-ADA-16835P
  • Online Inquiry

    refresh