Rabbit anti- Galectin 3/LGALS3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16381P

• Product Name:
• Rabbit anti- Galectin 3/LGALS3 Monoclonal Antibody

• Synonym:
• L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3

• Description:
• The antibody against Galectin 3/LGALS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-250 human Galectin 3/LGALS3 (NP_002297.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 human Galectin 3/LGALS3 (NP_002297.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Galectin 3/LGALS3

• Form:
• Liquid

• Immunogen Sequence:
• MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

• Gene ID:
• 3958

• Uniprot-ID:
• P17931

• Purification Method:
• HeLa, Rat spleen, NIH/3T3, C2C12

• Positive Samples:
• Affinity purification