Rabbit anti- CD31/PECAM1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16577P

• Product Name:
• Rabbit anti- CD31/PECAM1 Monoclonal Antibody

• Synonym:
• CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1

• Description:
• The antibody against CD31/PECAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD31/PECAM1

• Form:
• Liquid

• Immunogen Sequence:
• AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Gene ID:
• 5175

• Uniprot-ID:
• P16284

• Purification Method:
• U-937, THP-1

• Positive Samples:
• Affinity purification