Rabbit anti- BRAF V600E Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16435P

• Product Name:
• Rabbit anti- BRAF V600E Monoclonal Antibody

• Synonym:
• NS7; B-raf; BRAF1; RAFB1; B-RAF1; BRAF-1; BRAF V600E

• Description:
• The antibody against BRAF V600E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 507-606 of B-Raf (NP_004324.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 507-606 of B-Raf (NP_004324.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• BRAF V600E

• Form:
• Liquid

• Immunogen Sequence:
• KTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG

• Gene ID:
• 673

• Uniprot-ID:
• P15056

• Purification Method:
• 293T transfected with BRAF V600E

• Positive Samples:
• Affinity purification