Rabbit anti- ALOX5 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15528P

• Product Name:
• Rabbit anti- ALOX5 Monoclonal Antibody

• Synonym:
• 5-LO; 5LPG; LOG5; 5-LOX; ALOX5

• Description:
• The antibody against ALOX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ALOX5（NP_000689.1） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ALOX5（NP_000689.1）.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ALOX5

• Form:
• Liquid

• Immunogen Sequence:
• MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPC

• Gene ID:
• 240

• Uniprot-ID:
• P09917

• Purification Method:
• Raji, U-2 OS, Mouse lung

• Positive Samples:
• Affinity purification