Mouse anti-Mouse Sarm1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-07345P

• Product Name:
• Mouse anti-Mouse Sarm1 Monoclonal Antibody

• Synonym:
• Sarm; MyD885; A830091I15Rik; Sarm1

• Description:
• The antibody against Sarm1 was raised in Mouse using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Sarm1 (NP_766383.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Sarm1 (NP_766383.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Sarm1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVE

• Gene ID:
• 237868

• Uniprot-ID:
• Q6PDS3

• Purification Method:
• Raji, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification