• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Mouse anti-Mouse Sarm1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-07345P
  • Product Name:
  • Mouse anti-Mouse Sarm1 Monoclonal Antibody
  • Synonym:
  • Sarm; MyD885; A830091I15Rik; Sarm1
  • Description:
  • The antibody against Sarm1 was raised in Mouse using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Sarm1 (NP_766383.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Mouse
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Sarm1 (NP_766383.2).
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • Sarm1
  • Form:
  • Liquid
  • Immunogen Species:
  • Mouse
  • Immunogen Sequence:
  • MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAAGGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVE
  • Gene ID:
  • 237868
  • Purification Method:
  • Raji, Mouse brain, Rat brain
  • Positive Samples:
  • Affinity purification
  • Pre product:Mouse anti- N6-methyladenosine / m6A Monoclonal Antibody-ADA-07258P
  • Online Inquiry

    refresh