Mouse anti-Human PTEN Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-10945P

• Product Name:
• Mouse anti-Human PTEN Monoclonal Antibody

• Synonym:
• BZS; DEC; CWS1; GLM2; MHAM; TEP1; MMAC1; PTEN1; 10q23del; PTENbeta; PTEN

• Description:
• The antibody against PTEN was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 204-403 of human PTEN (P60484) as the immunogen. The monoclonal antibody exists as a isotype IgG1, kappa, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 204-403 of human PTEN (P60484).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG1, kappa

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PTEN

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV

• Gene ID:
• 5728

• Uniprot-ID:
• P60484

• Purification Method:
• HeLa, Mouse testis, Rat lung

• Positive Samples:
• Affinity purification