Mouse anti-Human LC3B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-12816P

• Product Name:
• Mouse anti-Human LC3B Monoclonal Antibody

• Synonym:
• LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3

• Description:
• The antibody against LC3B was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1) as the immunogen. The monoclonal antibody exists as a isotype IgG2a, Kappa, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG2a, Kappa

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• LC3B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

• Gene ID:
• 81631

• Uniprot-ID:
• Q9GZQ8

• Purification Method:
• HeLa, NIH/3T3, C6

• Positive Samples:
• Affinity purification