Mouse anti-Human CD34 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-00163P

• Product Name:
• Mouse anti-Human CD34 Monoclonal Antibody

• Synonym:
• CD34; CD34 molecule; GIG3; MORT1

• Description:
• The antibody against CD34 was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 32-290 of human CD34 (P28906) as the immunogen. The monoclonal antibody exists as a isotype IgG2b, kappa, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 32-290 of human CD34 (P28906).

• Species Reactivity:
• Human

• Isotype:
• IgG2b, kappa

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD34

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT

• Gene ID:
• 947

• Uniprot-ID:
• P28906

• Purification Method:
• 293T, A-549

• Positive Samples:
• Affinity purification