Mouse anti-Human Caspase-3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-10503P

• Product Name:
• Mouse anti-Human Caspase-3 Monoclonal Antibody

• Synonym:
• CPP32; SCA-1; CPP32B; Caspase-3

• Description:
• The antibody against Caspase-3 was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574) as the immunogen. The monoclonal antibody exists as a isotype IgG1, Kappa, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG1, Kappa

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Caspase-3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII

• Gene ID:
• 836

• Uniprot-ID:
• P42574

• Purification Method:
• Jurkat, HeLa, 293T, Mouse lung, Mouse liver

• Positive Samples:
• Affinity purification