Mouse anti-Human BDNF Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-12446P

• Product Name:
• Mouse anti-Human BDNF Monoclonal Antibody

• Synonym:
• ANON2; BULN2; BDNF

• Description:
• The antibody against BDNF was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human BDNF (P23560) as the immunogen. The monoclonal antibody exists as a isotype lgG2a, kappa, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Mouse

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human BDNF (P23560).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• lgG2a, kappa

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• BDNF

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

• Gene ID:
• 627

• Uniprot-ID:
• P23560

• Purification Method:
• Mouse lung, Mouse brain, Rat lung

• Positive Samples:
• Affinity purification