• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Mouse anti- VHL Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-02940P
  • Product Name:
  • Mouse anti- VHL Monoclonal Antibody
  • Synonym:
  • RCA1; VHL1; pVHL; HRCA1; VHL
  • Description:
  • The antibody against VHL was raised in Mouse using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of VHL(NP_000542.1) as the immunogen. The monoclonal antibody exists as a isotype IgG2b, Kappa, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Mouse
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of VHL(NP_000542.1)
  • Species Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG2b, Kappa
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • VHL
  • Form:
  • Liquid
  • Immunogen Sequence:
  • MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLP
  • Gene ID:
  • 7428
  • Purification Method:
  • HeLa, Raji, 293T, Mouse embryo, Rat testis
  • Positive Samples:
  • Affinity purification
  • Pre product:Mouse anti-Human CEACAM5 Monoclonal Antibody-ADA-02865P
  • Online Inquiry

    refresh