Cat#:RPH-NP309;Product Name:Recombinant Human PDGF-Associated Protein / PAP Protein;Synonym:28 kDa Heat- and Acid-Stable Phosphoprotein, PDGF-Associated Protein, PAP, PDGFA-Associated Protein 1, PAP1, PDAP1, HASPP28;Description:Recombinant Human PDGF-Associated Protein Protein is produced in E.coli and the target gene encoding Met1-Lys181 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGD GAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRR EREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQ SLSLNK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human PDGF-Associated Protein /PAP Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 0.1mM PMSF, 2mM DTT, pH 8.0.;Stability:Recombinant Human PDGF-Associated Protein /PAP Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human PDGF-Associated Protein /PAP Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;