• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human PD-L1 / B7-H1 / CD274 Protein Online Inquiry

  • Cat#:
  • RPH-NP310
  • Product Name:
  • Recombinant Human PD-L1 / B7-H1 / CD274 Protein
  • Synonym:
  • Programmed Cell Death 1 Ligand 1, PD-L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
  • Description:
  • Recombinant Human Programmed Cell Death 1 Ligand 1 Protein is produced in Human Cells and the target gene encoding Phe19-Thr239 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQ RARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVT SEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRR LDPEENHTAELVIPELPLAHPPNERTVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human PD-L1/B7-H1/CD274 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.
  • Stability:
  • Recombinant Human PD-L1/B7-H1/CD274 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human PD-L1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PD-L1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PD-L1 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human PDGF-Associated Protein I PAP Protein I Advanced Biomart
  • Online Inquiry

    refresh