Cat#:RPH-NP311;Product Name:Recombinant Human PD-L1 / B7-H1 / CD274 Protein;Synonym:Programmed Cell Death 1 Ligand 1, PD-L1, PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1;Description:Recombinant Human Programmed Cell Death 1 Ligand 1 Protein is produced in Human Cells and the target gene encoding Phe19-Thr239 is expressed with a Fc tag at the C-terminus.;Source:Human cells;AA Sequence:FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQ RARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVT SEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRR LDPEENHTAELVIPELPLAHPPNERTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human PD-L1/B7-H1/CD274 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.;Stability:Recombinant Human PD-L1/B7-H1/CD274 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PD-L1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PD-L1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PD-L1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Programmed Cell Death 1 Ligand 1 Protein is produced in Human Cells and the target gene encoding Phe19-Thr239 is expressed with a Fc tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human PD-L1/B7-H1/CD274 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Stability:
Recombinant Human PD-L1/B7-H1/CD274 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human PD-L1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PD-L1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PD-L1 protein samples are stable below -20°C for 3 months.