Cat#:RPH-NP312;Product Name:Recombinant Human PD-L2 / B7-DC / CD273 Protein;Synonym:Programmed Cell Death 1 Ligand 2, PD-1 Ligand 2, PD-L2, PDCD1 Ligand 2, Programmed Death Ligand 2, Butyrophilin B7-DC, B7-DC, CD273, PDCD1LG2, B7DC, CD273, PDCD1L2, PDL2;Description:Recombinant Human Programmed Cell Death 1 Ligand 2 Protein is produced in Human Cells and the target gene encoding Leu20-Pro219 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGK ASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYP LAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQME PRTHPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human PD-L2/B7-DC/CD273 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human PD-L2/B7-DC/CD273 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PD-L2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PD-L2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PD-L2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;