Cat#:RPH-NP313;Product Name:Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1 / ACOX1 Protein;Synonym:Peroxisomal acyl-coenzyme A oxidase 1, AOX, Palmitoyl-CoA oxidase, Straight-chain acyl-CoA oxidase, SCOX;Description:Recombinant Human Peroxisomal Acyl-coenzyme A oxidase 1 Protein is produced inand the target gene encoding Met1-Leu660 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPD FQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPT LLHQATAEQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKW WPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYL KMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIAIRYSA VRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPEL HALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFL MKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAK NLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLY GISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYE NLFEWAKNSPLNKAEVHESYKHLKSLQSKL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, pH7.0, 20% gly, 3mM DTT .;Stability:Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Peroxisomal Acyl-coenzyme A oxidase 1 Protein is produced inand the target gene encoding Met1-Leu660 is expressed with a His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, pH7.0, 20% gly, 3mM DTT .
Stability:
Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Peroxisomal Acyl-coenzyme A Oxidase 1/ACOX1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.