Cat#:RPH-NP308;Product Name:Recombinant Human PDCD1 / PD-1 / CD279 Protein;Synonym:Programmed cell death protein 1,PDCD1,PD-1,hPD-1,CD279;Description:Recombinant Human Programmed Cell Death Protein 1 Protein is produced in Human Cells and the target gene encoding Leu25-Gln167 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQP GQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTA HPSPSPRPAGQFQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human PDCD1/PD-1/CD279 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.;Stability:Recombinant Human PDCD1/PD-1/CD279 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PDCD1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human PD1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PDCD1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human PDCD1 / PD-1 / CD279 Protein
Online Inquiry
Cat#:
RPH-NP308
Product Name:
Recombinant Human PDCD1 / PD-1 / CD279 Protein
Synonym:
Programmed cell death protein 1,PDCD1,PD-1,hPD-1,CD279
Description:
Recombinant Human Programmed Cell Death Protein 1 Protein is produced in Human Cells and the target gene encoding Leu25-Gln167 is expressed with a Fc tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human PDCD1/PD-1/CD279 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Stability:
Recombinant Human PDCD1/PD-1/CD279 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human PDCD1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human PD1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PDCD1 protein samples are stable below -20°C for 3 months.