Cat#:RPH-NP284;Product Name:Recombinant Human Macrophage Migration Inhibitory Factor / MIF Protein;Synonym:Macrophage migration inhibitory factor, MIF, MMIF, Glycosylation-inhibiting factor, GLIF, L-dopachrome tautomerase, Phenylpyruvate tautomerase;Description:Recombinant Human Macrophage migration inhibitory factor Protein is produced in E.coli and the target gene encoding Met1-Ala115 is expressed.;Source:E. coli;AA Sequence:MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSI GKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Macrophage Migration Inhibitory Factor/MIF Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Macrophage Migration Inhibitory Factor/MIF Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Macrophage Migration Inhibitory Factor/MIF Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;