Cat#:RPH-NP285;Product Name:Recombinant Human Malate Dehydrogenase, Cytoplasmic / MDH1 Protein;Synonym:Malate Dehydrogenase Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDH1, MDHA;Description:Recombinant Human Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Ser2-Ala334 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLK DVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGN PANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVN HAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGT PEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKES AFEFLSSALEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:Specific Activity is greater than 1700pmol/min/ug;Formulation:Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.;Stability:Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Ser2-Ala334 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
Specific Activity is greater than 1700pmol/min/ug
Formulation:
Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Stability:
Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.