• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Malate Dehydrogenase, Cytoplasmic / MDH1 Protein Online Inquiry

  • Cat#:
  • RPH-NP285
  • Product Name:
  • Recombinant Human Malate Dehydrogenase, Cytoplasmic / MDH1 Protein
  • Synonym:
  • Malate Dehydrogenase Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDH1, MDHA
  • Description:
  • Recombinant Human Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Ser2-Ala334 is expressed with a His tag at the C-terminus.
  • Source:
  • E.coli
  • AA Sequence:
  • SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLK DVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGN PANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVN HAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGT PEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKES AFEFLSSALEHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Bioactivity:
  • Specific Activity is greater than 1700pmol/min/ug
  • Formulation:
  • Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
  • Stability:
  • Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human Malate Dehydrogenase, Cytoplasmic/MDH1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human MIF Protein I Advanced Biomart
  • Online Inquiry

    refresh