Cat#:RPH-NP286;Product Name:Recombinant Human Malate Dehydrogenase, Mitochondrial / MDH2 Protein;Synonym:Malate dehydrogenase, mitochondrial, MDH2;Description:Recombinant Human Malate Dehydrogenase Protein is produced in Human Cells and the target gene encoding Ala25-Lys338 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:AKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDC LKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEV FKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFP QDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETE CTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLKVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Malate Dehydrogenase, Mitochondrial / MDH2 Protein
Online Inquiry
Cat#:
RPH-NP286
Product Name:
Recombinant Human Malate Dehydrogenase, Mitochondrial / MDH2 Protein
Synonym:
Malate dehydrogenase, mitochondrial, MDH2
Description:
Recombinant Human Malate Dehydrogenase Protein is produced in Human Cells and the target gene encoding Ala25-Lys338 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Malate Dehydrogenase, Mitochondrial/MDH2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.