Cat#:RPH-NP287;Product Name:Recombinant Human Maleylacetoacetate Isomerase / MAA / GSTZ1 Protein;Synonym:Maleylacetoacetate Isomerase, MAAI, GSTZ1-1, Glutathione S-Transferase Zeta 1, GSTZ1;Description:Recombinant Human Glutathione S-Transferase Zeta 1 Protein is produced in E.coli and the target gene encoding Met1-Ala216 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKID GITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW AQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLV LEAFQVSHPCRQPDTPTELRALEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1 Protein was supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0.;Stability:Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;