Cat#:RPH-NP283;Product Name:Recombinant Human Lymphotoxin β R / LTBR / TNFRSF3 / TNFRrp Protein;Synonym:Tumor Necrosis Factor Receptor Superfamily Member 3, Lymphotoxin-Beta Receptor, Tumor Necrosis Factor C Receptor, Tumor Necrosis Factor Receptor 2-Related Protein, Tumor Necrosis Factor Receptor Type III, TNF-RIII, TNFR-III, LTBR, D12S370, TNFCR, TNFR3, TNFRSF3;Description:Recombinant Human Lymphotoxin beta receptor Protein is produced in Human Cells and the target gene encoding Gln31-Met227 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYL TICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEV GKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM LMVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrp Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human LTBR protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LTBR protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human LTBR protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;