Cat#:RPH-NP282;Product Name:Recombinant Human Lymphocyte Activation Gene 3 / LAG-3 / CD223 Protein;Synonym:Lymphocyte activation gene 3 protein,LAG3,LAG-3,Protein FDC,CD223;Description:Recombinant Human LAG-3 Protein is produced in Human Cells and the target gene encoding Leu23-Gly434 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPA APSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVH LRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESP HHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPC RLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVT LAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQC QLYQGERLLGAAVYFTELSSPGHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Lymphocyte Activation Gene 3/LAG-3/CD223 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Lymphocyte Activation Gene 3/LAG-3/CD223 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human LAG3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LAG3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human LAG3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Lymphocyte Activation Gene 3/LAG-3/CD223 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human Lymphocyte Activation Gene 3/LAG-3/CD223 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human LAG3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human LAG3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human LAG3 protein samples are stable below -20°C for 3 months.