Cat#:RPH-NP281;Product Name:Recombinant Human L-Xylulose Reductase / DCXR Protein;Synonym:L-Xylulose Reductase, XR, Carbonyl Reductase II, Dicarbonyl/L-Xylulose Reductase, Kidney Dicarbonyl Reductase, kiDCR, Sperm Surface Protein P34H, DCXR;Description:Recombinant Human L-Xylulose Reductase Protein is produced in E.coli and the target gene encoding Met1-Cys244 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLD SLVRECPGIEPVCVDLGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRA VIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVN AVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG FWAC;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human L-Xylulose Reductase/DCXR Protein was supplied as a 0.2 μm filtered solution of 50mM Tris, 150mM NaCl, 1mM DTT, 30% Glycerol, 1mM DTT, pH 8.0.;Stability:Recombinant Human L-Xylulose Reductase/DCXR Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human L-Xylulose Reductase/DCXR Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;