Cat#:RPH-NP182;Product Name:Recombinant Human High Mobility Group Protein B1 / HMGB1 Protein;Synonym:High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMGB1, HMG1;Description:Recombinant Human High Mobility Group Protein B1 Protein is produced in Human Cells and the target gene encoding Gly2-Glu215 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKA DKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGE MWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEED EEEEEDEEDEDEEEDDDDEVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human High Mobility Group Protein B1/HMGB1 Protein was supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.;Stability:Recombinant Human High Mobility Group Protein B1/HMGB1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human High Mobility Group Protein B1/HMGB1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;